Author: Srivastava, Sukrit; Kamthania, Mohit; Singh, Soni; Saxena, Ajay K; Sharma, Nishi
Title: Structural basis of development of multi-epitope vaccine against Middle East respiratory syndrome using in silico approach Document date: 2018_11_21
ID: 33h22ikl_21
Snippet: From the screened and shortlisted CTL and HTL epitopes, two MEVs were designed using EAAAK and GGGGS as short peptide rigid and flexible linkers, respectively ( Figure 1A and B). To enhance the immune response, hBD-2 (PDB ID: 1FD3, sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCG LPGTKCCKKP) and hBD-3 (PDB ID: 1KJ6, sequence: GII NTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK CCRRKK) were used as adjuvants for both MEVs at N and C terminals, respectively. 17, 18,.....
Document: From the screened and shortlisted CTL and HTL epitopes, two MEVs were designed using EAAAK and GGGGS as short peptide rigid and flexible linkers, respectively ( Figure 1A and B). To enhance the immune response, hBD-2 (PDB ID: 1FD3, sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCG LPGTKCCKKP) and hBD-3 (PDB ID: 1KJ6, sequence: GII NTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRK CCRRKK) were used as adjuvants for both MEVs at N and C terminals, respectively. 17, 18, [50] [51] [52] [53] Upon lung infection, the expression of hBD-2 and hBD-3 was found to be increased. β-Defensins are involved in chemotactic activity for memory T cells, monocytes, and immature dendritic cells as well as in degranulation of mast cells. Thus, hBDs enhance innate and adaptive immunity and therefore were chosen here as adjuvants for the design of MEVs.
Search related documents:
Co phrase search for related documents- dendritic cell and immature dendritic cell: 1, 2
- dendritic cell and immature dendritic cell monocyte: 1, 2
- dendritic cell and immune response: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66
- dendritic cell and immune response enhance: 1, 2
- dendritic cell and increase find: 1
- dendritic cell and lung infection: 1, 2, 3, 4, 5, 6, 7, 8, 9
- dendritic cell and mast cell: 1, 2, 3, 4, 5
- HTL CTL epitope and immune response: 1, 2, 3, 4
- HTL CTL epitope and immune response enhance: 1, 2
Co phrase search for related documents, hyperlinks ordered by date