Selected article for: "amino acid and mutant protein"

Title: The v-sis oncoprotein loses transforming activity when targeted to the early Golgi complex
  • Document date: 1994_12_2
  • ID: 2otgb2w8_9
    Snippet: The final constructs utilize the transmembrane domain and cytoplasmic tail of TGN38. sis-TGN38 was encoded by oligonucleotides D496 and D497. The sense strand oligonucleotide D496 encodes the amino acid sequence VTESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKV-TRRPKASDYQRLNLKL* Again the first two amino acids correspond to 238 and 239 of v-sis, and the remaining 57 amino acids correspond to residues 284-340 of TGN38, encoding the transmembrane domain .....
    Document: The final constructs utilize the transmembrane domain and cytoplasmic tail of TGN38. sis-TGN38 was encoded by oligonucleotides D496 and D497. The sense strand oligonucleotide D496 encodes the amino acid sequence VTESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKV-TRRPKASDYQRLNLKL* Again the first two amino acids correspond to 238 and 239 of v-sis, and the remaining 57 amino acids correspond to residues 284-340 of TGN38, encoding the transmembrane domain and cytoplasmic tail of this protein. A mutant version, sis-TGN38A, was also constructed using oligonncleotides 13498 and D499. These oligonucleotides encode a truncated version of the sequence shown above: VTESSHFFA-YLVTAAVLVAVLYIAYHNKRS* and with the final amino acid changed from a lysine to a serine.

    Search related documents:
    Co phrase search for related documents