Title: The v-sis oncoprotein loses transforming activity when targeted to the early Golgi complex Document date: 1994_12_2
ID: 2otgb2w8_9
Snippet: The final constructs utilize the transmembrane domain and cytoplasmic tail of TGN38. sis-TGN38 was encoded by oligonucleotides D496 and D497. The sense strand oligonucleotide D496 encodes the amino acid sequence VTESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKV-TRRPKASDYQRLNLKL* Again the first two amino acids correspond to 238 and 239 of v-sis, and the remaining 57 amino acids correspond to residues 284-340 of TGN38, encoding the transmembrane domain .....
Document: The final constructs utilize the transmembrane domain and cytoplasmic tail of TGN38. sis-TGN38 was encoded by oligonucleotides D496 and D497. The sense strand oligonucleotide D496 encodes the amino acid sequence VTESSHFFAYLVTAAVLVAVLYIAYHNKRKIIAFALEGKRSKV-TRRPKASDYQRLNLKL* Again the first two amino acids correspond to 238 and 239 of v-sis, and the remaining 57 amino acids correspond to residues 284-340 of TGN38, encoding the transmembrane domain and cytoplasmic tail of this protein. A mutant version, sis-TGN38A, was also constructed using oligonncleotides 13498 and D499. These oligonucleotides encode a truncated version of the sequence shown above: VTESSHFFA-YLVTAAVLVAVLYIAYHNKRS* and with the final amino acid changed from a lysine to a serine.
Search related documents:
Co phrase search for related documents- amino acid and final amino acid: 1, 2, 3, 4, 5, 6, 7
- amino acid and final construct: 1, 2, 3, 4, 5, 6
- amino acid and mutant version: 1
- amino acid and protein cytoplasmic tail: 1, 2, 3, 4, 5, 6, 7, 8
- amino acid and protein cytoplasmic tail transmembrane domain: 1
- amino acid and show sequence: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18
- amino acid sequence and cytoplasmic tail: 1, 2, 3, 4, 5, 6, 7, 8, 9
- amino acid sequence and final construct: 1, 2
- amino acid sequence and protein cytoplasmic tail: 1, 2
- amino acid sequence and show sequence: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11
- cytoplasmic tail and final construct: 1
- cytoplasmic tail and mutant version: 1
- cytoplasmic tail and protein cytoplasmic tail: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60
- cytoplasmic tail and protein cytoplasmic tail transmembrane domain: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10
- mutant version and protein cytoplasmic tail: 1
- mutant version and protein cytoplasmic tail transmembrane domain: 1
Co phrase search for related documents, hyperlinks ordered by date