Title: The v-sis oncoprotein loses transforming activity when targeted to the early Golgi complex Document date: 1994_12_2
ID: 2otgb2w8_8
Snippet: Similar constructs were also designed to encode an extended cytoplasmic tail derived from VSV-G. The oligonucleotides encoding sis-E1-G were designated D455 and D456. The sense strand oligonucleotide I)455 encodes the amino acid sequence VTYNLFITAFLLFLTIILQYGYATRVGIHLCIK-LKHTKKRQIYTDIEMNRLGK*. The first 25 amino acids are the same as in the sis-El construct, but the final 28 originate from the COOH-terminus of the VSV-G protein, sis-EI(QI)-G and .....
Document: Similar constructs were also designed to encode an extended cytoplasmic tail derived from VSV-G. The oligonucleotides encoding sis-E1-G were designated D455 and D456. The sense strand oligonucleotide I)455 encodes the amino acid sequence VTYNLFITAFLLFLTIILQYGYATRVGIHLCIK-LKHTKKRQIYTDIEMNRLGK*. The first 25 amino acids are the same as in the sis-El construct, but the final 28 originate from the COOH-terminus of the VSV-G protein, sis-EI(QI)-G and sis-El(ins)-G were constructed in the same manner.
Search related documents:
Co phrase search for related documents- amino acid and oligonucleotide strand: 1
- amino acid and sense oligonucleotide strand: 1
- amino acid and sis El construct: 1
- cytoplasmic tail and oligonucleotide strand: 1
- cytoplasmic tail and sense oligonucleotide strand: 1
- cytoplasmic tail and similar construct: 1
- cytoplasmic tail and sis El construct: 1
- oligonucleotide strand and sense oligonucleotide strand: 1
Co phrase search for related documents, hyperlinks ordered by date