Selected article for: "cytoplasmic tail and final construct"

Title: The v-sis oncoprotein loses transforming activity when targeted to the early Golgi complex
  • Document date: 1994_12_2
  • ID: 2otgb2w8_8
    Snippet: Similar constructs were also designed to encode an extended cytoplasmic tail derived from VSV-G. The oligonucleotides encoding sis-E1-G were designated D455 and D456. The sense strand oligonucleotide I)455 encodes the amino acid sequence VTYNLFITAFLLFLTIILQYGYATRVGIHLCIK-LKHTKKRQIYTDIEMNRLGK*. The first 25 amino acids are the same as in the sis-El construct, but the final 28 originate from the COOH-terminus of the VSV-G protein, sis-EI(QI)-G and .....
    Document: Similar constructs were also designed to encode an extended cytoplasmic tail derived from VSV-G. The oligonucleotides encoding sis-E1-G were designated D455 and D456. The sense strand oligonucleotide I)455 encodes the amino acid sequence VTYNLFITAFLLFLTIILQYGYATRVGIHLCIK-LKHTKKRQIYTDIEMNRLGK*. The first 25 amino acids are the same as in the sis-El construct, but the final 28 originate from the COOH-terminus of the VSV-G protein, sis-EI(QI)-G and sis-El(ins)-G were constructed in the same manner.

    Search related documents:
    Co phrase search for related documents
    • amino acid and oligonucleotide strand: 1
    • amino acid and sense oligonucleotide strand: 1
    • amino acid and sis El construct: 1
    • cytoplasmic tail and oligonucleotide strand: 1
    • cytoplasmic tail and sense oligonucleotide strand: 1
    • cytoplasmic tail and similar construct: 1
    • cytoplasmic tail and sis El construct: 1
    • oligonucleotide strand and sense oligonucleotide strand: 1
    Co phrase search for related documents, hyperlinks ordered by date