Selected article for: "flow cytometry and western blot"

Author: Paquin, Ashley; Onabajo, Olusegun O.; Tang, Wei; Prokunina-Olsson, Ludmila
Title: Comparative Functional Analysis of 12 Mammalian IFN-?4 Orthologs
  • Document date: 2016_1_1
  • ID: sqxrwgif_11
    Snippet: The mouse (MAB-IFN-l4) and rabbit (RAB-IFN-l4) monoclonal antibodies for IFN-l4 have previously been described (Prokunina-Olsson and others 2013). MAB-IFN-l4 (MABF227; Millipore) was raised against a synthetic peptide KALRDRYEEEALSWGQRNCSFRPRRDSPRPS corresponding to amino acids 44-74 and RAB-IFN-l4 was raised against a synthetic peptide PGSSRKVPGAQKRR HKPRRADSPRC corresponding to amino acids 128-152 of the human IFN-l4 protein (NP_001263183). The.....
    Document: The mouse (MAB-IFN-l4) and rabbit (RAB-IFN-l4) monoclonal antibodies for IFN-l4 have previously been described (Prokunina-Olsson and others 2013). MAB-IFN-l4 (MABF227; Millipore) was raised against a synthetic peptide KALRDRYEEEALSWGQRNCSFRPRRDSPRPS corresponding to amino acids 44-74 and RAB-IFN-l4 was raised against a synthetic peptide PGSSRKVPGAQKRR HKPRRADSPRC corresponding to amino acids 128-152 of the human IFN-l4 protein (NP_001263183). The antibodies do not cross-react with the human IFN-l3 protein. To reduce unspecific background in flow cytometry experiments, MAB-IFN-l4 was buffer exchanged to PBS using Zeba 7k spin columns (Thermo Scientific), and for Western blot and confocal imaging, the MAB-IFN-l4 was used without buffer exchange.

    Search related documents:
    Co phrase search for related documents