Author: Paquin, Ashley; Onabajo, Olusegun O.; Tang, Wei; Prokunina-Olsson, Ludmila
                    Title: Comparative Functional Analysis of 12 Mammalian IFN-?4 Orthologs  Document date: 2016_1_1
                    ID: sqxrwgif_11
                    
                    Snippet: The mouse (MAB-IFN-l4) and rabbit (RAB-IFN-l4) monoclonal antibodies for IFN-l4 have previously been described (Prokunina-Olsson and others 2013). MAB-IFN-l4 (MABF227; Millipore) was raised against a synthetic peptide KALRDRYEEEALSWGQRNCSFRPRRDSPRPS corresponding to amino acids 44-74 and RAB-IFN-l4 was raised against a synthetic peptide PGSSRKVPGAQKRR HKPRRADSPRC corresponding to amino acids 128-152 of the human IFN-l4 protein (NP_001263183). The.....
                    
                    
                    
                     
                    
                    
                    
                    
                        
                            
                                Document: The mouse (MAB-IFN-l4) and rabbit (RAB-IFN-l4) monoclonal antibodies for IFN-l4 have previously been described (Prokunina-Olsson and others 2013). MAB-IFN-l4 (MABF227; Millipore) was raised against a synthetic peptide KALRDRYEEEALSWGQRNCSFRPRRDSPRPS corresponding to amino acids 44-74 and RAB-IFN-l4 was raised against a synthetic peptide PGSSRKVPGAQKRR HKPRRADSPRC corresponding to amino acids 128-152 of the human IFN-l4 protein (NP_001263183). The antibodies do not cross-react with the human IFN-l3 protein. To reduce unspecific background in flow cytometry experiments, MAB-IFN-l4 was buffer exchanged to PBS using Zeba 7k spin columns (Thermo Scientific), and for Western blot and confocal imaging, the MAB-IFN-l4 was used without buffer exchange.
 
  Search related documents: 
                                Co phrase  search for related documents- amino acid and spin column: 1
- amino acid and synthetic peptide: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31
- amino acid and western blot: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54
- buffer exchange and PBS exchange: 1, 2
- confocal imaging and monoclonal antibody: 1, 2
- confocal imaging and western blot: 1, 2, 3
- cytometry experiment and flow cytometry experiment: 1
- monoclonal antibody and synthetic peptide: 1, 2, 3, 4, 5, 6, 7
- monoclonal antibody and western blot: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39
- synthetic peptide and western blot: 1, 2, 3, 4
 
                                Co phrase  search for related documents, hyperlinks ordered by date