Author: de Melo, Ivan S.; Jimenez-Nuñez, Maria D.; Iglesias, Concepción; Campos-Caro, Antonio; Moreno-Sanchez, David; Ruiz, Felix A.; Bolívar, Jorge
Title: NOA36 Protein Contains a Highly Conserved Nucleolar Localization Signal Capable of Directing Functional Proteins to the Nucleolus, in Mammalian Cells Document date: 2013_3_13
ID: 0jx6mwiw_14
Snippet: KKLKKRNK [16] P14ARF RRGAQLRRPRHSHPTRARRCP [17] SVV-EX3 MQRKPTIRRKNLRKLRRK [15] NIK RKKRKKK [18] hLa QESLNKWKSKGRRFKGKGKGNKAAQPGSGKGK [19] ING-1 MTPKEKKAKTSKKKKRSKAKA [20] NOLP RKRIRTYLKSCRRMKRSGFEMSRPIPSHLT [21] IGF-I GTEASLQIRGKKKEQRREIGSRNAECRGKKGK [22] Werner VSRYNKFMKICALTKKGRNWLHKANTES [23] Nucleolin RGGGGGGGDFKPQGKKTKFR [24] Parafibromin RRAATENIPVVRRPDRK-(X) 301 -KKQGCQRENETLIQRRK [25] PTHrP GKKKKGKPGKRREQEKKKRRT [26] DEDD KRPARGRATLGSQPK.....
Document: KKLKKRNK [16] P14ARF RRGAQLRRPRHSHPTRARRCP [17] SVV-EX3 MQRKPTIRRKNLRKLRRK [15] NIK RKKRKKK [18] hLa QESLNKWKSKGRRFKGKGKGNKAAQPGSGKGK [19] ING-1 MTPKEKKAKTSKKKKRSKAKA [20] NOLP RKRIRTYLKSCRRMKRSGFEMSRPIPSHLT [21] IGF-I GTEASLQIRGKKKEQRREIGSRNAECRGKKGK [22] Werner VSRYNKFMKICALTKKGRNWLHKANTES [23] Nucleolin RGGGGGGGDFKPQGKKTKFR [24] Parafibromin RRAATENIPVVRRPDRK-(X) 301 -KKQGCQRENETLIQRRK [25] PTHrP GKKKKGKPGKRREQEKKKRRT [26] DEDD KRPARGRATLGSQPKRRKSV [27] Angiogenin IMRRRGL [28] Protein Alpha RRRANNRRR [29] MEQ RRRKRNRDAARRRRRKQ [30] Tat GRKKRRQRRAP [31] Rev RQARRNRRRRWERQR [32] Rex PKTRRRPRRSQRKRP [33] I14L MSRRNKRSRRRRKKPLNTIQ [34] These clusters of basic amino acids can be found in human proteins as MDM2 [16] , p14ARF [17] , SVV-EX3 [15] , NIK [18] , hLa [19] , ING-I [20] , NOLP [21] , IGF-I [22] , Werner [23] , Nucleolin [24] , Parafibromin [25] , PTHrP [26] , DEDD [27] , Angiogenin [28] and in several viral proteins such as Protein alpha [29] , MEQ (protein of Marek's disease virus (MDV) [30] , Tat [31] and Rev [32] (both proteins of human immunodeficiency virus type 1), Rex (protein of human T lymphotropic virus type [33] , I14L (protein of African swine fever virus) [34] . (Clontech, Mountainview, CA). As a control, the coding sequence of scPPX1 was fused directly with the Flag tag and cloned into the eukaryotic expression vector pIRES2-EGFP. Constructs were verified by sequencing (Servicio Central de Ciencia y TecnologÃa, University of Cadiz). Sequences of oligonucleotides and mutagenesis primers are available on request.
Search related documents:
Co phrase search for related documents- african swine fever virus and disease virus: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24
- african swine fever virus and human immunodeficiency: 1, 2
- african swine fever virus and human immunodeficiency virus: 1, 2
- african swine fever virus and swine fever: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73
- african swine fever virus and swine fever virus: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73
- african swine fever virus and viral protein: 1, 2, 3, 4, 5
- african swine fever virus protein and swine fever: 1, 2
- african swine fever virus protein and swine fever virus: 1, 2
- amino acid and basic amino acid: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54
- amino acid and basic amino acid cluster: 1, 2
- amino acid and code sequence: 1, 2
- amino acid and disease virus: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72
- amino acid and eukaryotic expression vector: 1, 2
- amino acid and expression vector: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36
- amino acid and Flag tag: 1
- amino acid and human immunodeficiency: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31
- amino acid and human immunodeficiency virus: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29
- amino acid and human immunodeficiency virus protein: 1, 2
- amino acid and human protein: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78
Co phrase search for related documents, hyperlinks ordered by date